DPCstruct | MC7435
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 82 ± 5 aa |
| Standard deviation of domain lengths | 4.55 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 44.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0458 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183C3H7 | 85-163 | LKDFVVHSQFLGVSHLVVLSRTSLSTHLRIIRNPQGPTLHFRVEKYSLARDVLSVQKRPVIYEELFQHAPLVVMNGFGG |
| E2M6W5 | 1-72 | MAPALHVTHLLAFTLTDVAPSMRMVRLSNGPTLSFRIERYSLMKDILHTTKKARSIGLGYLSPPLKLRRTSL |
| A0A3Q2UCH7 | 70-151 | None |
| A0A3P6S2V0 | 17-98 | None |
| A0A6A6MTB6 | 232-316 | None |
| A0A6A6MQD6 | 266-347 | None |
| A0A067H8E3 | 74-153 | None |
| A0A0H5CB06 | 66-155 | None |
| A0A183I2U7 | 102-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.