DPCstruct | MC7434
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 80 ± 8 aa |
| Standard deviation of domain lengths | 7.65 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 93.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 51.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E2M4V7 | 1-96 | MYHQLFKCTVFCSTHHTPIVPAKPPVWCEDNQSKCVKGSKQMLYWHQLEGNNIQVDGYDLAGSPKSPAYNAKCGFNDGCTRYDDDSG… |
| A0A814P0Z8 | 181-252 | KCMVTGTTSTRKLAVAKPPVYCEDDPSKCVKGAKQMIFYQQLTGNNVFNPPKMPTYNARMGFSDGAQNDIFE |
| A0A0K6GBJ9 | 31-102 | None |
| A0A135T1W8 | 166-246 | None |
| A0A2T3AXR2 | 254-349 | None |
| A0A545US58 | 201-284 | None |
| A0A819VPK9 | 306-379 | None |
| A0A179HA66 | 215-290 | None |
| A0A2T2P291 | 189-262 | None |
| A0A137Q4N5 | 175-257 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.