DPCstruct | MC7432
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 158 ± 6 aa |
| Standard deviation of domain lengths | 5.78 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 87.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 30.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S0TJH0 | 178-333 | VMCELFSLEALRALHRISTSSTNWWFPAHLADLLQKADERITSAYGMDIRQHLIIEYGSSLFSEPGLWQVGFDYLRETGDEGLRHLE… |
| E2M2Z7 | 11-157 | PEQALKHASQLDPWLAAHMADIMVLLDLLDSEVNSESELSKRDEYLLSYAEYVHADPTLWRETVSYMYSCADIGKERGDTVLMRVPL… |
| A0A0D2NGR2 | 214-375 | None |
| R7Q818 | 214-376 | None |
| A0A6J8B2D4 | 357-517 | None |
| A0A667X9F5 | 302-462 | None |
| A0A0L0GA93 | 107-273 | None |
| A0A7J8D0J7 | 2-153 | None |
| A0A3R7PX47 | 351-507 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.