DPCstruct | MC7431
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 277 ± 71 aa |
| Standard deviation of domain lengths | 71.12 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 71.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 17.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E2LZV6 | 40-322 | SLASDLKTLSNDVRAISGAIAEVLEVVKAQSISQPMGTSESASLLTVHPKFVALTEKDKAMYKAAGLKYWENVDWISSGACAQNADN… |
| A0A166D025 | 22-204 | TPFSAQGVPLGINLPPPPPPIFASAQEARKRGIQFWTKREWLNHRREKKGADDRERKQGPGALSRGENNLNHYIEELDGGPVDGTRV… |
| A0A4Y9XPT5 | 150-550 | None |
| A0A060SUC5 | 1-291 | None |
| A0A0C3IC44 | 2-181 | None |
| A0A0C3JLC3 | 59-321 | None |
| A0A4Q2D8X8 | 5-277 | None |
| A0A177T243 | 81-336 | None |
| S7PRB4 | 3-223 | None |
| A0A4Q9NIH3 | 133-453 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.