DPCstruct | MC743
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 129 ± 13 aa |
| Standard deviation of domain lengths | 13.21 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 65.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.75 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 35.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0068 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V6TKP5 | 1-113 | MALPPPTLAISDPPASSAPTHTPAPQPKSTSTMGETNGGSNTPLGDLGNIPAGQIRPGGAPARVYLNEKVVPYLLDGMKSVAREQPA… |
| A0A0J8RMP2 | 10-133 | SALQNNTLSEQLPSSTSSSHFPAAPNSTTASSHDGVRRRCKWGGANNGEAPIPAVDANNVPASAISQVRAGGAPARIYLNEKIVPYL… |
| A0A420IVL5 | 166-298 | None |
| A0A3N4K562 | 187-337 | None |
| A0A165J855 | 36-158 | None |
| A0A1F5LVA4 | 21-156 | None |
| M7PCV2 | 21-130 | None |
| S8C075 | 26-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.