DPCstruct | MC7429
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 125 ± 14 aa |
| Standard deviation of domain lengths | 14.19 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R4TQ46 | 3-120 | SQLRMIDSAPRAETGQTTFVRASGWDGMPEIWYRDRYLFTPENANGLMRLDLTYCQYIDTLRATKGTLGWPLLYGDILLRGKVFHEY… |
| A0A6H9Z4V5 | 98-220 | DERLPPDKRQIMEWELKTLEEAPGSGRLTAVRMPAGAQSRELWFYDMNHQRLELLELDYQSYLDNLLLMKGAPGWQYLFTQVDLCDG… |
| A0A3A4L6M6 | 2-92 | None |
| A0A061AAD7 | 48-174 | None |
| A0A1C6VZP1 | 209-331 | None |
| A0A5N7ZFW7 | 95-225 | None |
| A0A222SP67 | 11-136 | None |
| A0A2E4PAF0 | 12-131 | None |
| A0A7Y0A6S5 | 100-252 | None |
| A0A7D3VNY6 | 17-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.