DPCstruct | MC7427
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 76 ± 8 aa |
| Standard deviation of domain lengths | 7.56 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 38.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00590 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A161GLC2 | 2-66 | LELLRAACPEDRLVTFARAVSTPDQAIRTVALSEARPEMADMRTVVIVGNSQTRRVGAWVYSPRS |
| M3HZY1 | 175-242 | EASKIIKRHRSGDTPVALIKSAYRKQQNVFLSDLDNFLNYEIGMNTTVIVGSSNTFVYEGFMITPRGY |
| A0A645CDC2 | 259-339 | None |
| A0A7V3F938 | 574-645 | None |
| A0A3M1S909 | 9-81 | None |
| A0A2E9WWN2 | 34-112 | None |
| A0A0E2DW47 | 180-247 | None |
| A0A843FTB6 | 4-74 | None |
| A0A843G8D9 | 59-134 | None |
| A0A292YRD2 | 173-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.