DPCstruct | MC7426
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 77 ± 10 aa |
| Standard deviation of domain lengths | 9.93 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 29.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20132 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A560BBU1 | 16-92 | VAEVDGAGDLVFDAAIVGSLLGLEPGAFMEELKKGMVHQVHERGTGVDHGRRRVTFRYRARQSVLVLDARGHALHVA |
| A0A159Z163 | 3-86 | AISFEDGRIEVDAALVAKALQMEPEALRAALRSGAVTSQCETGMDEDAGRFRLTFFSATRRLRLTVAASGEVLQTSTADYRRKP |
| A0A7W6MQ02 | 177-259 | None |
| A0A0U3P797 | 7-82 | None |
| A0A1G3ZWI3 | 5-73 | None |
| A0A2T8HZ28 | 114-189 | None |
| A0A0H1AVS7 | 2-69 | None |
| A0A4V2B223 | 1-62 | None |
| A0A3S0DX07 | 2-75 | None |
| A0A7X0FDR0 | 2-50 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.