DPCstruct | MC7424
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 197 ± 16 aa |
| Standard deviation of domain lengths | 15.98 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q9L7Q2 | 1094-1296 | EKLIPFYNKDYIVYQGNKLNKEHHLNTKEVLSVTAMNNNEFITNLDEANKIIVHYADGTKDYFNLSSSSEGLSNVKEYTITDLGIKY… |
| A0A7X1Q7Q5 | 1-206 | IEKLLPFYNRETIVKYGNLVETSSNLYKKELLSVVPMKDKEIISDVNGNKSSINKLLLYYTDNTSETINIQYQSDFSNVAEYSLNGT… |
| K1AD43 | 4-159 | None |
| A0A1S8KNB2 | 243-453 | None |
| E0TKA8 | 1-191 | None |
| A0A1Y4RMU6 | 73-276 | None |
| Q59986 | 1017-1215 | None |
| A0A4M3JQ27 | 215-405 | None |
| A0A496LID0 | 561-769 | None |
| A0A496LBQ2 | 3-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.