DPCstruct | MC7421
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 344 ± 28 aa |
| Standard deviation of domain lengths | 28.42 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 19.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A323ULK4 | 139-456 | TPTPATPSGQPVPQPNTTCPDWVHDQYVVQGHDGKIYRTWHPQIDPVYWCYFGHEHGSDPSQLPALKAAMDRGDLRPAFGYVSTKAQ… |
| A0A7C4Q941 | 141-469 | TPVPPTATFTSPPPSATPPHHEPTATATAHHHEPTATAAAPVAGQPCPESLHDPHTWHAPVHSSGCYFGHEHGDAPPNWVAASRWAP… |
| A0A853U3H8 | 49-455 | None |
| A0A1F8NZU3 | 313-635 | None |
| A0A1X6NU37 | 105-442 | None |
| A0A3D0CYB5 | 73-431 | None |
| A0A1X6NPK8 | 240-574 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.