DPCstruct | MC742
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 143 ± 11 aa |
| Standard deviation of domain lengths | 11.25 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 72.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.79 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 34.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G3HL03 | 78-224 | SEEEADLEKQKAEMALLVMDEEEDSKKHFNYDKIVEHQNLSKKKKKQLMKKKELLEDDFEVNVNDSRFQAMYTSHLFNLDPSDPNFK… |
| A0A0J8RJH2 | 1-137 | MDDKTSTIKHFDMNEIEKAQKRAKKAGKHRKGKKDEATMPVDDFKVDVKDPRFQRIYESHEYAIDPTNPRFRQTDGMKALLEEGRKR… |
| A0A4Y7NLL4 | 1088-1217 | None |
| A0A674J2J4 | 3-144 | None |
| A0A194RH31 | 527-666 | None |
| A0A284R9R7 | 532-667 | None |
| A0A4W6DJ63 | 63-231 | None |
| A0A653DW03 | 216-356 | None |
| A7F8Y7 | 54-201 | None |
| C4WX71 | 32-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.