DPCstruct | MC7418
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 154 ± 13 aa |
| Standard deviation of domain lengths | 12.72 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 29.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13160 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A434MLD2 | 2-143 | IVLAFALSLVLLLITALHVYWGIGGIWPGRDAASCARAVVGFRGVDEMPAPFASFAVAACLGLATLWPMALEGVFATPFPKAGLAAT… |
| A0A0K1JID2 | 5-156 | VSSQPSSDALQRADRAARLAVPAVLGAIGALHLSWAAGSTWPKSTAAELGEVVISSGSLPPAGACIVVGVGLIGAAGVVAALRPSSS… |
| A0A2X3L1M0 | 4-147 | None |
| A0A2A3HHE8 | 10-176 | None |
| A0A2G6K0B7 | 167-316 | None |
| A0A832AMS4 | 26-182 | None |
| A0A7W0GA58 | 105-256 | None |
| A0A1R4HNC8 | 4-141 | None |
| A0A7C5CDU3 | 18-160 | None |
| A0A7X5VB59 | 2-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.