DPCstruct | MC7417
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 183 ± 21 aa |
| Standard deviation of domain lengths | 21.10 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 24.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K2T6R5 | 51-236 | LKPNTLVIWDRQPYRIIELAERPHDLWGDKHEMRYATALEHWDRYPHGERPEKATWDGRPYVFVLQPDGKPHEKPLHLIGPANHPWN… |
| A0A1X0A5N4 | 52-219 | WSPSDANRRKFQPEPGDIVTWGDFKPWVVIDIREGVPHRDNPGAEYTVYRMRPVGVDDNKQDIHRGWTYGGPTVLHDHYGLCVHCGE… |
| A0A5D3FAL2 | 6-172 | None |
| A0A075V9Z6 | 1-186 | None |
| A0A1C5ACG5 | 42-267 | None |
| A0A1S2GPU5 | 2-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.