DPCstruct | MC7413
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 104 ± 14 aa |
| Standard deviation of domain lengths | 13.56 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 49.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A447LHL8 | 85-207 | IPDYNTAAPGSGTGPFIMQPEGLGRLFAIDKMAEGPFPEHYEPVETPIGTNPLHPNVVSNPAARLLPEDAKRIGDRTAFPYVGTTYR… |
| A0A448QTB1 | 2-93 | ADFGSAPPNSNVSPFIMQPEGVSRLFAIDKLVDGPFPEHYEPIESPIGTNPLHPNVVQNPVVRILDSDKASFGTADEFPYVGTTYRL… |
| A0A3S4IJJ9 | 100-218 | None |
| A0A4P0XNN7 | 66-162 | None |
| A0A484Z9N5 | 1-83 | None |
| A0A485D191 | 175-263 | None |
| A0A1V4VMS2 | 24-131 | None |
| A0A3S4F9T6 | 1-85 | None |
| A0A853AIW8 | 194-310 | None |
| A0A4U9J3P7 | 34-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.