DPCstruct | MC7412
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 317 ± 61 aa |
| Standard deviation of domain lengths | 60.61 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 74.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 18.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T2P1A1 | 2-174 | VPANTQLPLIPVTDLELVIYFYNLVSRPMVALRLYARGWGPARITNALNKYRKPDPPYLRNTCTVKCNTAFRRGKEMYGEDWHEANH… |
| A0A1Y2M853 | 1-337 | MARKHGQNEDAVFACRMHCSQSVKHLDKYHFLRPTLSDHPLHNMVSTITTRRIRNSRPSFGGAAPSSTIPFPRKGNMTAVEILTFLP… |
| A0A6A5TQP7 | 1-276 | None |
| A0A6A6JWS6 | 193-455 | None |
| A0A6A5TC31 | 6-329 | None |
| A0A2T2NZP8 | 2-307 | None |
| A0A2T2NZM3 | 19-248 | None |
| A0A6A5TRL9 | 126-455 | None |
| A0A364N4R6 | 600-928 | None |
| A0A364N4I4 | 1-371 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.