DPCstruct | MC741
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 172 ± 9 aa |
| Standard deviation of domain lengths | 8.65 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 82.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 24.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A063BV25 | 73-230 | MEKLKNVELAQKYLILLRDVGKLQAQARSHLPGSPKAALEPYSKLKALATKLRTLPGNESLHLVDHVQRVTESLWDEMKRTMSEELE… |
| A0A0J8RJD5 | 1-187 | MEKLGRLEIAKGYMELLGRVNRISEDTLSVIQRSPNDALSLYSEVRALASSLVSVQVAAEGAAPHLIDYTTKLVGSLKDALQKEYSG… |
| A0A0E9NPA2 | 100-267 | None |
| A0A7R9D7M6 | 100-276 | None |
| X8JVY5 | 562-740 | None |
| A7F0C1 | 125-283 | None |
| A0A0D0C429 | 32-211 | None |
| A0A0C9LWI2 | 126-287 | None |
| D4AMF6 | 108-284 | None |
| A0A833Z2G8 | 70-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.