DPCstruct | MC7408
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 191 ± 25 aa |
| Standard deviation of domain lengths | 25.29 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2M3X3 | 1-181 | MNTFFPTIQLYFESGLSCTIDGGLLRGSTVGLDPDLRFRLTDCAHEEQGRAVQGILPEGPGGAGARIRILEAALSQRTSITVKVDTD… |
| A0A165E1C3 | 181-348 | NPDGIDPSTIVGKVLKRVHRGAAHPNLTLVFADDSVVQVKIEGYHPNARGLSKELEMDSSLDDFLASSAASTVDLLILDCALVRLTD… |
| A0A0W0F0I0 | 4-177 | None |
| A0A7C8VHQ1 | 2-185 | None |
| A0A5C3QM89 | 2-246 | None |
| A0A5C3KUX4 | 14-184 | None |
| A0A4Q9N3L6 | 1-218 | None |
| A0A6A5U4W7 | 80-250 | None |
| A0A4Q9PBF3 | 77-294 | None |
| A0A6A5VGX2 | 64-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.