DPCstruct | MC7407
Metacluster Properties and Pfam Annotations
| Number of structural domains | 94 |
|---|---|
| Mean domain length (aa) | 122 ± 25 aa |
| Standard deviation of domain lengths | 25.18 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 80.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 30.55 |
| Pfam Score | 99.14 |
| Assigned Pfam label(s) | PF01491- PF00795 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3HXZ8 | 2-87 | ESLYRKLAAASDEYEFDVDMNAGALTIEFEEPRERFVVSPNSPVRQIWVSAHVKSYKLDWNGSAFALEDGRTLEQLIADAIRVRIP |
| A0A1Y2M3Q1 | 134-284 | RALSASTRTRSIIPDVENPPPKQSEEHETPTVPTDISTSEFHERADEYLNELVERLEEQQETNPDIEVEYSAGVLRVDYISKQLSYV… |
| A0A5E4BTT7 | 168-316 | None |
| A0A376TYI0 | 1-122 | None |
| U6LLQ6 | 20-173 | None |
| A0A2A2KAJ3 | 463-559 | None |
| A0A7R9WTW2 | 52-208 | None |
| A0A5J4ZB50 | 24-152 | None |
| A0A7R8X484 | 11-137 | None |
| Q4UCG7 | 10-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.