DPCstruct | MC7405
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 149 ± 22 aa |
| Standard deviation of domain lengths | 22.21 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 17.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X0J1E5 | 2-163 | RHDLAYWQVHDTEDDCDLIIRSNSGHVFYCHICPSQFIRSPTITEQYFKCLELLRTGEVEIDDFYEEDAYEWLLNCFEPLIARLAPS… |
| A0A1Y2M2Z3 | 1-125 | MIELYLGDLNASLTVMSRGKRFHIFIVMDDFCGKQGDALVQTFLDYKKNMGDDPCAMEEFQEWMVRPCISHMEHFKPPTPRAAPLSL… |
| A0A1R3S272 | 7-128 | None |
| W9XNS0 | 1-146 | None |
| A0A1V6NVN7 | 2-158 | None |
| G3JBJ4 | 3-170 | None |
| W9WP88 | 1-184 | None |
| A0A0A1TFA1 | 4-146 | None |
| A0A0G4MB53 | 322-458 | None |
| A0A094J4I6 | 14-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.