DPCstruct | MC7402
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 164 ± 6 aa |
| Standard deviation of domain lengths | 6.12 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 85.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 47.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2LY98 | 1-172 | MLHTYFAVSPFPVTSAVPDVSRPSLKRLARWIRDDLEILVAREGPGALHPDDVVTLHDYFIALRRSTTITARDLRATGIHRAVKAIA… |
| A0A2T2PBI6 | 24-174 | DHRLRQIASWIRDDLDPVIAREGPDHLRADDVLSLHEIFQALRSSTAISALDLRATGIHRAVMEVSGTATRWPGRLADDCDRIITVW… |
| A0A6A6SYX9 | 7-173 | None |
| R7YKQ0 | 5-167 | None |
| A0A7U2HUD9 | 2-163 | None |
| A0A3M7FKT5 | 415-580 | None |
| A0A0C9MEN3 | 1-169 | None |
| A0A6A5WDX3 | 6-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.