DPCstruct | MC7400
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 127 ± 17 aa |
| Standard deviation of domain lengths | 17.45 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.99 |
| Pfam Score | 98.39 |
| Assigned Pfam label(s) | PF01267- CL0591 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B6VT92 | 6-127 | ETELSDDQKKGIAKWFLVNAPAGEIQYVSRDLKLVLNDDDVYNEAASEAFPVYNKSHLISLTMPGGFGDVLVTSYGELQDNEYLDPK… |
| A0A1E3I6F3 | 3-145 | DITLEQKCKLASTLVEQTPPGEINDVINDIRAIIADDEALMPHVLPALRAYNLKQLHVVEHPEEEGLPAHTSLLSEASIVPGAETER… |
| A0A5J4P0V0 | 1-141 | None |
| A0A0F7SSZ8 | 2-139 | None |
| A0A1Y1WHE0 | 4-125 | None |
| A0A1J8QTS1 | 1-131 | None |
| A0A842ZDL3 | 3-91 | None |
| A0A6G0XY94 | 2-136 | None |
| A0A146H2P0 | 130-274 | None |
| A0A3M7M2N0 | 41-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.