DPCstruct | MC740
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 279 ± 34 aa |
| Standard deviation of domain lengths | 34.25 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 69.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 25.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J8RGZ0 | 7-268 | LWVGLIYYPPQQGFSSLLFCRYLGKRTLEGTYHKGELYTDSRQFTMGYSRFCPEPQKRAGKENTDASTNHEEHSAQGSSEEPSAAVP… |
| A0A1L9PIX6 | 18-317 | VFVQILTPLTTRELLHLATVSQRFHALVLRLLHYRLLLTASLTEYKLILECFHPTSKLTEPHVFCKYIGTPSLSDKYEGEGSLYENI… |
| W3XE75 | 1-244 | None |
| A0A507QPD3 | 16-286 | None |
| J5JT06 | 798-1035 | None |
| A0A6G1G508 | 40-397 | None |
| J3NQ68 | 15-332 | None |
| A0A517L2D3 | 55-345 | None |
| A0A4T0WWQ0 | 2-264 | None |
| A0A4U0UA19 | 2-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.