DPCstruct | MC74
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 113 ± 8 aa |
| Standard deviation of domain lengths | 7.72 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V5WBZ0 | 7-118 | LDDPNLHAKLHDVLDALATIRCFVEDTDHLSDRELYTWLWSEGLREETPDLSQLGGAWHMSPIGSGNQEDTAIFLKYYASKKERRRW… |
| A0A3D0NI28 | 28-149 | LSEEHLREELWAVIERLYQGRIILDFTDHLSDHELYNLIRKEILPTAIKRVDLPDNYFHWDCSVAGRVPEISDGEWYPEPVIDSLIW… |
| A0A2V8J2B6 | 1-114 | None |
| A0A7C5BSG8 | 71-186 | None |
| A0A4Q3UDM8 | 44-162 | None |
| A0A2V2S0H5 | 237-349 | None |
| A0A645EQH0 | 170-288 | None |
| A0A2G4IVQ1 | 74-187 | None |
| A0A836UGH9 | 29-129 | None |
| A0A0F9HSJ7 | 5-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.