DPCstruct | MC7399
Metacluster Properties and Pfam Annotations
| Number of structural domains | 132 |
|---|---|
| Mean domain length (aa) | 90 ± 15 aa |
| Standard deviation of domain lengths | 15.42 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U0WT75 | 114-213 | CTLPEYRAQLNGRTAQLRASSCRDLGLSEKLFLLMVPNTAVVGDAIWALAGGQALYLLRPLDVESKKYMFIGECYAQGLMDGEVVRM… |
| A0A1Y2LT25 | 9-105 | ARWFNSAFKVVSMNRKFAVTDKGYIGWAPSDTRKGDVVALFPGGNVPYVLRPVSQPDSAQSSTSSNTRNHRYEFLGDTYIHGIMHGE… |
| A0A6A5V3F6 | 118-235 | None |
| A0A6G1IF16 | 341-446 | None |
| A0A5N6EY57 | 59-149 | None |
| A0A366S9U5 | 884-988 | None |
| A0A194VBG8 | 168-265 | None |
| A0A438NF17 | 441-539 | None |
| A0A2V1DE12 | 3-83 | None |
| W9JVW7 | 348-429 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.