DPCstruct | MC7398
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 103 ± 7 aa |
| Standard deviation of domain lengths | 6.88 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A261QCX4 | 1-98 | MTKKYLPEAASNQYADVYLHSPVPIVFINSDKVYLAFIDKDLSYEDAHDSKSGDYLIGYYNEQYFGVGLYDHKETKESIEDCYSRVF… |
| A0A2A8SGZ6 | 15-124 | KKLASEFDAVFIMKEHLSEAAQSKYAKVYKEAGIPFFFIETRKSYIPFVDEKLSYEDFPEVESGEYAAGYFQSGEDIQSWGYGLYND… |
| A0A031IL96 | 3-96 | None |
| A0A0A2UQK0 | 84-196 | None |
| A0A0B0HS38 | 17-112 | None |
| A0A1S7FQU4 | 62-159 | None |
| A0A5C5TGK6 | 131-242 | None |
| A0A073KCS4 | 2-96 | None |
| A0A1R0YCA2 | 6-107 | None |
| A0A1Q2L3Q9 | 6-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.