DPCstruct | MC7396
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 326 ± 21 aa |
| Standard deviation of domain lengths | 21.24 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 64.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.25 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J3DHU8 | 1-355 | MDHALEPVCMKRICFIAFPVGELSYLCQCKRLRDVVHGDLLPSAEMITVLSQEYGVPLPDEDLFTRKPPVPLFSSDACILLGKLSRE… |
| A0A7J8I8Q3 | 1-297 | MKQTALHLHSTGMRKAFQTLTKIYCICLYSSKLREVITGDLLPSSDMIRDLSQEFGLPISLEEIANETLWTIPSHPTSNLEDFQSRN… |
| A0A7J7KTV5 | 390-711 | None |
| A0A7J8GAH6 | 193-505 | None |
| A0A5E4CEG5 | 2-321 | None |
| K7G8V7 | 502-861 | None |
| A0A7S1U4M0 | 269-584 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.