DPCstruct | MC7395
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 79 ± 7 aa |
| Standard deviation of domain lengths | 6.88 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 49.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0302 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M1CXR0 | 24-95 | SHLYYDVPPSKVPLIYSPSYDIAFFGIEKLHPFDSSKWGRICRFLTKEGIMDQKHVVEPVEATKDDLLVVAT |
| A0A7J8I046 | 6-85 | QLYQHVPETKLPIVYSPRYNITFLGLEKLHPFDAGKWGKVISFLKEENLVSDCVLVEAREASEEDLLVVHTRRYLNELKD |
| A0A368FMC4 | 107-179 | None |
| A0A7S3LT68 | 87-162 | None |
| A0A4W6FW92 | 1-64 | None |
| A0A671E9N7 | 1-84 | None |
| A0A7R9AEQ5 | 20-93 | None |
| A0A3Q2PD18 | 1-68 | None |
| A0A2I3SAS6 | 1-84 | None |
| A0A7J8NBV6 | 92-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.