DPCstruct | MC7394
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 122 ± 10 aa |
| Standard deviation of domain lengths | 9.84 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P4R929 | 233-361 | EWFAPQWILDTIPRRSPFVPQMGDELIYFRQGHEAYVRAVRKSKIYSLNLQKQPWNKMDLREQEFVKIVGIKYEVGPPTLCCLKLAF… |
| A0A090LY19 | 383-504 | SWFCAEQLTIGSYVPQLGDKVVYIAQGHYERMQEHGKDWHDEAPWQTLTQMRFVEPCVVSSLRYIISDDGTYETHGLLELKLIDPSC… |
| A0A453I905 | 173-285 | None |
| A0A3Q0IYQ4 | 861-989 | None |
| A0A0K0DWW8 | 974-1095 | None |
| A0A061RNP1 | 605-730 | None |
| A0A7R9L4C5 | 291-422 | None |
| M4DY02 | 7-120 | None |
| A0A1D6FEM2 | 325-442 | None |
| A0A0B1TLP6 | 4-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.