DPCstruct | MC7393
Metacluster Properties and Pfam Annotations
| Number of structural domains | 412 |
|---|---|
| Mean domain length (aa) | 138 ± 21 aa |
| Standard deviation of domain lengths | 21.08 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.43 |
| Pfam Score | 94.41 |
| Assigned Pfam label(s) | CL0274- PF15928- CL0123- CL0260- PF00334 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q4BHE5 | 7-144 | NMERTFVAVKPDGVQRGLCGEIIKRLEQRGFRLVAAKFTQASEEHMKKHYLDLKDKPFYAGLCKYMSSGPVLATVWEGQNVVKLVRM… |
| A0A7J8HDK0 | 9-145 | PQNTLALIKPHATHEQREEIFSIIKEAGFDITQMKEILLTKEQADKIYFKITNKDFYKDVLEILSEGPSVVMILTKWNAVSEWRRLM… |
| A0A812L8C4 | 148-274 | None |
| A0A482VHA0 | 1-112 | None |
| A0A839IIM2 | 3-130 | None |
| A0A1E7FZD6 | 351-488 | None |
| A0A317XS20 | 2-152 | None |
| R6M2W8 | 489-635 | None |
| A0A066VT68 | 10-170 | None |
| A0A2G3CRZ0 | 8-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.