DPCstruct | MC7391
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 284 ± 36 aa |
| Standard deviation of domain lengths | 35.95 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 27.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11831 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W2SLF2 | 3-202 | RLVAWDVQNNAPSEIYEENDLKAASELVKKDCDVGPPLDASMWAVIDQCSTELVHIRGKFTRIAVLGRGEQIEALHSQFQIYRDWMN… |
| A0A7J8GNF5 | 43-320 | QAIRDAERVKEMKRMHKAVQKDLPRPSEVNETILRPLNVEPPLTDLQKSEELIKKEMITMLHYDLLHHPYEPSGNKKGKTVGFATNN… |
| A0A835UEG9 | 2-291 | None |
| A0A7S1XTN1 | 2-309 | None |
| A0A7S4E430 | 312-589 | None |
| A0A5B6VVC4 | 483-799 | None |
| B7FNH9 | 12-275 | None |
| A0A1R3HP14 | 53-367 | None |
| A0A183KHI7 | 23-265 | None |
| A0A423VTG0 | 428-763 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.