DPCstruct | MC739
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 145 ± 12 aa |
| Standard deviation of domain lengths | 12.27 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 35.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E3SDR6 | 154-301 | EMKVNDLFVEFENGTTESEVKAILENYNMTMNYSIDYNVDYFEDKYYISVDKDKIMDVRNELNKGTNWIAPVFPDIKKGNYYIITVT… |
| A0A0E3QZY7 | 1-168 | MQIPTYRETKIAGFLIQFENGTTEPEAKAVLENYNMTLNYSLDCNWNNGGYKYYIKVYKDDLPNVVRDGLKKDENWTDSALPSFTKG… |
| A0A0F8IEP6 | 1-125 | None |
| Q8TMK1 | 195-340 | None |
| A0A2I0PWS9 | 579-728 | None |
| M1PUH2 | 2-143 | None |
| A0A832TZJ4 | 1-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.