DPCstruct | MC7389
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 102 ± 23 aa |
| Standard deviation of domain lengths | 22.89 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 84.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 40.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01632 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S4RD73 | 16-102 | GRGKRKTVKAVVKRFLRLDCGLWLRRQAGCKKRLWKKRKPRIRRLRQHVLCNKWQSKLLDKMVTDFWKRRKWYENDPYQLYHERTNF |
| A0A0K2TP00 | 35-129 | PEDRGIQLYNETNGERTKLKDAEDRFKRLDWGMYIRTRAGRSTKLHKISPGERWNLQQHVFTARWHTRDLNKMMDNSTKKIRHFPED… |
| A0A3Q0IWC9 | 2-75 | None |
| A0A7R9FXP0 | 1-78 | None |
| A0A0B1TKN2 | 15-95 | None |
| A0A183STJ8 | 45-160 | None |
| A0A6J0TT33 | 104-217 | None |
| A0A7R9DXZ4 | 21-92 | None |
| U4U6W7 | 71-176 | None |
| A0A7R9JDS7 | 10-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.