DPCstruct | MC7388
Metacluster Properties and Pfam Annotations
| Number of structural domains | 265 |
|---|---|
| Mean domain length (aa) | 230 ± 48 aa |
| Standard deviation of domain lengths | 47.62 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 84.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.59 |
| Pfam Score | 99.68 |
| Assigned Pfam label(s) | CL0617- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K2TMP1 | 98-355 | KDIEYELEECKGTMPDCDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSST… |
| A0A446QFP1 | 11-168 | NTRRTLLEKYNLLAVGSSHGTLFDPKEFPYRTGDGKYNDPHNAEAGSQYTFFGRNMKPVDQQDELMSPDPFVVATKLLARREYKDTG… |
| A0A7R9PNX2 | 444-629 | None |
| C3ZKZ9 | 466-753 | None |
| A0A6S7G762 | 102-369 | None |
| A0A7R9KYB4 | 2-225 | None |
| A0A182TJ35 | 26-266 | None |
| A0A7R9KTT7 | 171-348 | None |
| A0A1C3YA84 | 400-623 | None |
| A0A1I3HH56 | 198-463 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.