DPCstruct | MC7387
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 501 ± 132 aa |
| Standard deviation of domain lengths | 131.54 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 75.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 19.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14750 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K2T9U2 | 86-641 | AIHFHSQQFSAVSELACTTLGMKIAIRNNNMTRIKHIFTQEVFTENVVAAHAIKVPVTDKLSCNNSGFLPVHCIHQLLKSRAFSKNK… |
| A0A6V7Y6D8 | 3-402 | AANINITKRLNATMSGYLPVHCICAMLHWRSFSKYSTSINEWVKTQMLECHTPIHPIVPHLLENFASSCIPSETYPHFNQSIDEQFF… |
| E5QCH1 | 491-1112 | None |
| A0A5K3FK48 | 185-611 | None |
| A0A1I8HA52 | 450-763 | None |
| U9SL78 | 14-568 | None |
| A0A1I8IMQ3 | 1-356 | None |
| A0A1S8W8G5 | 358-884 | None |
| F0WBI7 | 327-1106 | None |
| A0A3P7EFB2 | 2-440 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.