DPCstruct | MC7386
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 86 ± 1 aa |
| Standard deviation of domain lengths | 1.36 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 88.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 68.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12070 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K2SXM1 | 1-87 | MNEEERKIVDEFCHLLEKSKQLFNGLRDMPQYGHKQWQAYFGRTFDIYTKLWKYQQQHRGILDERYGLKRWQIGEVASKIGQLYYHY |
| A0A6P3HSM1 | 51-137 | IPQGERKTVTDFCYLLDKSKQLFNGLRDLPQYGQKQWQSYFGRTFDVYTKLWKFQQQHRQVLDNRYGLKRWQIGEIASKIGQLYYHY |
| A0A2P8XNG4 | 7-89 | None |
| A0A7N6ADH4 | 10-96 | None |
| A0A0M0K1X8 | 3-88 | None |
| A0A819ICU8 | 388-472 | None |
| A0A1Y1W115 | 62-150 | None |
| D3B9Y2 | 105-191 | None |
| L8GQ81 | 1-88 | None |
| A0A2U9B9V9 | 407-493 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.