DPCstruct | MC7385
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 294 ± 40 aa |
| Standard deviation of domain lengths | 39.65 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 70.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 34.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6AEJ0 | 59-347 | TGKHPSNMRQAKPVLIPAGEPQYHSPYKPTPASSRSTRLQARTDAPKPTICMPSVLHGPHPDSKLCQDFHWVPYPLGLLPYDSWHKL… |
| A0A4V1X1S9 | 290-623 | SQEPVPAVSNPKNPPAPTKLIPSTIYKPAVLHLPHSLSKIGQNGHWIPYPLGLMPYDSWYKLHHGNGGDIQPKLALSCPICGGKREM… |
| A0A2I0RVW4 | 19-331 | None |
| A0A3N4JNU7 | 1-298 | None |
| A0A6A6B1A2 | 1-236 | None |
| A0A178AF28 | 1-286 | None |
| A0A1J9QS83 | 15-354 | None |
| A0A3M7F837 | 97-359 | None |
| A0A2D3VD27 | 1-311 | None |
| A0A1V8UEY9 | 10-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.