DPCstruct | MC7384
Metacluster Properties and Pfam Annotations
| Number of structural domains | 145 |
|---|---|
| Mean domain length (aa) | 250 ± 49 aa |
| Standard deviation of domain lengths | 48.86 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 67.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 20.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T0JV17 | 2-160 | KGKEFLEIACPFFKKDPSKYSECLKRHRLKKIEEVKEHLWQQHRIPFYCPICKRDFPTARGRDRHIVDRICAIQEVFPFEGVSDDQR… |
| A0A4V1WYA1 | 18-234 | YKPYTETPPSFPEPTPITQQAKSATRTKRKRRVQSSRKVGAGPRQHCRPRLMEDVDETRPLACPFAKHDPINAPGCWEFAADNLARL… |
| A0A370TWI9 | 536-834 | None |
| A0A4Q4ZUJ1 | 72-413 | None |
| A0A420UE71 | 239-452 | None |
| A0A4Q4W1M0 | 19-258 | None |
| S3CPB5 | 37-265 | None |
| A0A2K0W0Z9 | 106-361 | None |
| A0A5C6T253 | 25-249 | None |
| A0A2H3GGL5 | 927-1105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.