DPCstruct | MC7382
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 109 ± 13 aa |
| Standard deviation of domain lengths | 13.32 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 73.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 51.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10791 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A178CHX0 | 33-135 | LEMSFVIRRAVSTLVPPKVANPEGIGAAKNAVRMARIAKFYEKLPKGSAPARAPSGPLGWYQAKYFGKNPSAAPIWHVIFGIMAMGY… |
| A0A4Q4R4Z2 | 30-123 | MSFMQKRGLSTLIPPKIASPNAIGSSPNAVRMQKVVSFYEKLPRGPAPEPEAKGLLGRYQKKYMGKNPSGRPLVHVIGFLIALGYAQ… |
| C4JDM1 | 1-120 | None |
| A0A0F2MGD4 | 76-193 | None |
| A0A1L9V317 | 1-110 | None |
| S3DB36 | 71-166 | None |
| A0A2B7WXW0 | 1-137 | None |
| A0A397TR37 | 28-127 | None |
| T5APV7 | 1-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.