DPCstruct | MC7381
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 124 ± 18 aa |
| Standard deviation of domain lengths | 18.15 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 42.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11938 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8HNR4 | 45-140 | PCHTCRGLVDSFNKGLERTIRDNFGGGNTAWEEEKLSKYKDSETRLVEVLESVCSKSDYECHRLLELSEELVESWWFHKQQEAPDLF… |
| A0A226PNM9 | 1-114 | MAPGPAPRAALLLLLLQLLLLPPPPAVGAGGRRRLACSTCRGIVDRFKQGLADTAKKNFGGGNTAWEEKTLSKYESSEIRLVEITEN… |
| A0A6P6CYQ0 | 97-187 | None |
| A0A6P4YUU0 | 2-153 | None |
| A0A2H2I3J9 | 4-133 | None |
| A0A5F8AAL3 | 21-144 | None |
| A0A1B6K8T9 | 29-130 | None |
| K7HMP9 | 202-311 | None |
| A0A7J7UIL3 | 17-152 | None |
| A0A7J7J259 | 24-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.