DPCstruct | MC7380
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 248 ± 37 aa |
| Standard deviation of domain lengths | 36.84 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J4SK29 | 97-334 | RPDGQTETSHHHARANPADTGSASVTTEFGRFAGYKNRHRAVWLRGTGHRLTGAVLADNAVGATFASHESFLQDSLLVGETANKGAP… |
| A0A226PIA0 | 2-284 | QGCRGVALSPLKNETKYTKAGLFIGKGVKTTRASAEDPREYLTVDNARFRPHQDADPEKPRVPAVIDGLIAFKNNDHGAWARGGDII… |
| A0A2T7PJC5 | 28-265 | None |
| K1PGW7 | 602-879 | None |
| A0A1S3IWK5 | 552-764 | None |
| D2VL17 | 460-681 | None |
| A0A832Q8Y9 | 175-428 | None |
| A0A7V4NL41 | 599-810 | None |
| A0A7S1DC02 | 18-310 | None |
| A0A832Q9S7 | 9-284 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.