DPCstruct | MC7378
Metacluster Properties and Pfam Annotations
| Number of structural domains | 91 |
|---|---|
| Mean domain length (aa) | 113 ± 12 aa |
| Standard deviation of domain lengths | 12.36 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 38.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9GCZ3 | 1-110 | MNGTELIQKERKRQIESEGWSAKHDSKHTDASLALAAVCYAAPGRLFVRKDYANGPAFEDPWPESWEERHDKREFDGNVLIPNEKLP… |
| A0A2N7QRG3 | 40-174 | VFAAMRLALVAALEKLAGTGVGLILAERQRQITAEGYTPERDAKTYAQVPDGHYAAELPCAAAAYACFAGMIADFRDLQRTQERPEH… |
| A0A6N8RVN4 | 242-356 | None |
| A0A0E3CB28 | 88-211 | None |
| A0A024KD75 | 66-191 | None |
| A0A2Z6AAX7 | 21-140 | None |
| A0A845V686 | 106-245 | None |
| A0A7W4VI38 | 164-276 | None |
| A0A7R7TC29 | 308-447 | None |
| A0A225M1P8 | 435-544 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.