DPCstruct | MC7376
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 126 ± 14 aa |
| Standard deviation of domain lengths | 14.20 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 22.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G5JCQ3 | 1-127 | MSPLPLTPEFFPDVIEKQQEYTLTITPIAYRWLKANQTVRYEAKDNLIEYSQGRLTIRNGEGNYKMMAQSVSLDEQKNQQWECINLP… |
| B7KMH7 | 5-125 | AEIQQQRTSLIAPTLIALLKAKKVLKSPDYSYNAEKNQTTLVNGEHLIIFNGFYLKLIDKQTGIEKMIATGTRNQITGDIDWKTHSV… |
| A0A3C0ND51 | 152-280 | None |
| A0A4V2JMT1 | 78-205 | None |
| E0UM94 | 289-393 | None |
| T2JXH0 | 44-173 | None |
| T2JJZ3 | 139-267 | None |
| T2JJU1 | 234-363 | None |
| A0A6M0FS42 | 182-312 | None |
| A0A3D1PAE6 | 4-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.