DPCstruct | MC7374
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 209 ± 19 aa |
| Standard deviation of domain lengths | 19.49 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 31.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10151 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9NNX8 | 87-260 | GRGFPWSKMFMVLLVFAAGFIAQDIRSHGSFAESTTALHLRNSGVTAVSQQALSKIKVYSSQGFSWLETNTPHYYSECARVLGPLMD… |
| R4V202 | 1-227 | MITLNEELLKKVTVSRTFPWKTGSFLLLFAVVALLSYDIKKHGSFRSSSTGRFLNDIGALQYGEHAWARTKFYSDKSYRWAEANVPH… |
| A0A0L7KTS8 | 369-552 | None |
| A0A2J7PI28 | 247-473 | None |
| A0A6L5DHK1 | 128-340 | None |
| V9IAG3 | 1-218 | None |
| A0A182QKY0 | 37-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.