DPCstruct | MC7372
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 183 ± 32 aa |
| Standard deviation of domain lengths | 31.60 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.64 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 25.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15604 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A837JSS3 | 25-155 | GLKCGTVEYHHKQKPNKVTDIRELKRQIRGQIRAFNRILKEDGMAGLKQRINNYNAALEREGRDYVKGLGPAGEGNVWLHEPDMRVG… |
| M1Q8E1 | 4-155 | NYKTKFDSEEFARQLKDQEKGMNELTVHEYRENRNRFIDKGRAIEGNAYQQAARERALRDKIDELFEQGLTLKEAKTQANEWMKTQA… |
| A0A3S5FA95 | 89-263 | None |
| A0A0C6G1F1 | 940-1124 | None |
| A0A4V1V1A4 | 8-158 | None |
| A0A6P0Q4C9 | 180-387 | None |
| U2FSB3 | 395-593 | None |
| A0A5A9EA88 | 2-116 | None |
| A0A3A9VW67 | 414-611 | None |
| A0A1M4S3B6 | 47-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.