DPCstruct | MC7371
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 153 ± 18 aa |
| Standard deviation of domain lengths | 18.48 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 27.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C4EEJ6 | 18-182 | VEHSCFSQYTLTQLAGSFVYGSAGITVEETGANVYIVNTTADDPFNAPAGSLRRAIEQANSTSLSARNIIKFEIPGSSPHTIFITAE… |
| A0A1Q7UHK5 | 41-170 | QAATFTVTTTADDGPGSLRQAIIVSNLNMGPSANVINFNIPGVGVKTISPLSPLPTITAPVTIDGFTQPGSGSSGLLIELDGTNAGA… |
| A0A521HAX0 | 5-158 | None |
| A0A533WPF1 | 5-156 | None |
| A0A351LAL7 | 13-171 | None |
| A0A2N5K2X3 | 223-387 | None |
| A0A2V6A7L3 | 261-447 | None |
| A0A7W0SK37 | 6-169 | None |
| A0LGN1 | 11-181 | None |
| A0A401XNS4 | 1-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.