DPCstruct | MC7370
Metacluster Properties and Pfam Annotations
| Number of structural domains | 614 |
|---|---|
| Mean domain length (aa) | 150 ± 32 aa |
| Standard deviation of domain lengths | 31.62 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 78.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 13.53 |
| Pfam Score | 67.72 |
| Assigned Pfam label(s) | PF16972- PF07907- PF03185- PF19873- PF12158 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3HG11 | 27-169 | RATSRAFSARQLVGFYNLAFQLVALVCSATAAYKLWQVYCGVRSYWFVPLDGVVAEIGLDDASGGGVYRVAYSYSLNGITYVGRRVT… |
| A0A3A0DIM3 | 92-230 | FGWLFFGFGMIFYWVFAANADYESIYFFASDVETAPGVVAATEELSFKVNKRSVHRVDYRFTVGGVERSGTSYTTDGGLGPKSKTTI… |
| A0A534B6L4 | 168-340 | None |
| A0A813UAK8 | 1-211 | None |
| A0A1J5KQM1 | 12-107 | None |
| A0A3N6UFE7 | 3-156 | None |
| A0A3N6VFN7 | 21-195 | None |
| A0A4R7QEK1 | 149-305 | None |
| A0A1S2PR06 | 3-154 | None |
| A0A150PEB9 | 286-418 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.