DPCstruct | MC737
Metacluster Properties and Pfam Annotations
| Number of structural domains | 590 |
|---|---|
| Mean domain length (aa) | 198 ± 47 aa |
| Standard deviation of domain lengths | 46.60 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 82.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 14.76 |
| Pfam Score | 82.79 |
| Assigned Pfam label(s) | PF12127- CL0137- PF16200- PF07059- PF01015 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T0QY19 | 5-192 | VTVRTGTRAVVTVDGLVVAVLDPGRHRLPGRRSRRAVEVVDVRENLLLITSQEAAALDVPGVRFAIAVRLRTVDPVAFGTVSQSPLD… |
| A0A7C5VAR6 | 9-164 | DNELARRQGGAVICRPQPLRLRWVFDQLATADAHVLEARFAASVRVANTDADRNMFFELLLCDRQSVTAQMLVEHFAPPLRAALTGL… |
| A0A1B0C7J1 | 280-490 | None |
| M2RWV7 | 8-161 | None |
| A0A6P8HKX5 | 6-142 | None |
| A0A4R2JBZ8 | 193-486 | None |
| A0A554IRU7 | 136-264 | None |
| A0A838YEW1 | 2-159 | None |
| A0A820C0Y9 | 23-120 | None |
| A0A1Q9C764 | 1-275 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.