DPCstruct | MC7368
Metacluster Properties and Pfam Annotations
| Number of structural domains | 97 |
|---|---|
| Mean domain length (aa) | 181 ± 25 aa |
| Standard deviation of domain lengths | 25.11 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 91.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.40 |
| Pfam Score | 98.86 |
| Assigned Pfam label(s) | CL0059- CL0103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I3RKG2 | 137-318 | ANSMLAHYDKSVEKMLPIWSFYGSETWCMIGYHAVSVLADMIVKGVKGFDYERAYEAMKTTAMNPHYDCLPEYRMMGYVPFDKEAES… |
| A0A7C3H168 | 184-369 | VRSLLAKAEQGGWLPIFPAWNSYTTEMIGDHGFSMVTDAFVKGFRDFDVQAAFRFMLKNAKETPPRPDYLDGKGRRALTSYLRYGYI… |
| A0A4Y9Y3F2 | 345-537 | None |
| A0A0F7RT46 | 277-488 | None |
| A0A1I3K072 | 822-1011 | None |
| A9WTL6 | 2-158 | None |
| A0A433DFS1 | 242-423 | None |
| A0A0J6YJF6 | 380-535 | None |
| A0A1M5EPK2 | 382-554 | None |
| A0A1V3WPM5 | 171-336 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.