DPCstruct | MC7367
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 113 ± 12 aa |
| Standard deviation of domain lengths | 11.88 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 14.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N2ZVU4 | 33-137 | IPENAVAQLTAVFSDSSQVCYKHKDSYYTRFRLFADADQVKLMSEKAATMPETMIFDYKKMKDSSFECRIRFHYPPDNNYVLKILRF… |
| A0A7C3E7C9 | 1-126 | MKKYIIIIVFLACGMQLLAQKTIQVNRFDAQHVSQTLDNGSKVLNLTFAGISSEDQAIELESFFRSYRGVEEFNLVYDATTQTATGT… |
| A0A2N2WFC6 | 19-134 | None |
| A0A3C0BB00 | 1-100 | None |
| A0A2M7KCN1 | 4-129 | None |
| A0A7C6AMD6 | 1-120 | None |
| A0A1F3R5A0 | 17-108 | None |
| A0A3D4CK65 | 59-154 | None |
| A0A1F3CCD8 | 1-129 | None |
| A0A2N2Y083 | 1-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.