DPCstruct | MC7366
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 126 ± 12 aa |
| Standard deviation of domain lengths | 12.04 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 56.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0307 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J9A3Y0 | 21-162 | TYQAADDPLYNCYRSVVQSTSEEDTLLGFATWEPPHGPYRHNYPWENFVKVSGAVKHCAFTVMALHGCILSEIQAPADRRHVFSNEL… |
| A0A2H5QS97 | 5-121 | VWEPPHGPYRSFNYPWKNYVKVSGALRHCAFMVMAMHRCVLSEIQAPPEKRQVFASELQNVGNEGAKVLRKRGDKVEKMERLSPEGI… |
| A0A4D9BPE3 | 336-469 | None |
| A0A804QQ24 | 1-131 | None |
| A0A287WB16 | 1-120 | None |
| A0A6A6NKY2 | 273-385 | None |
| A0A287FHR1 | 57-181 | None |
| A0A1D6FPC2 | 29-173 | None |
| A0A0A9DXM0 | 12-141 | None |
| A0A7J0ECL6 | 415-532 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.